Tap Titans 2 1.0.3

Media & Video App by Game Hive Corporation

Downloads: 22

Sponsored links
The battle continues as Sword Master defends the world from an all new, more dangerous army of invading Titans. Power up Sword Master in new ways to overcome the Titan's ever-increasing strength. The Titans are back, so pick up your sword and begin a new journey!

◆ Features ◆
๏ ENJOY the full RPG experience on the go
๏ TAP to defeat 120 all-new Titans in 10 gorgeous, hand-drawn realms
๏ RECRUIT heroes and loyal pets to help you repel the Titan onslaught
๏ UNLOCK unique skills to power up the way YOU choose to play
๏ PRESTIGE and cash in your progress for powerful artifacts and talents
๏ COLLECT equipments to customize your hero's looks and strengths to suit your playstyle
๏ CREATE or join clans to join forces with other players and defeat the almighty Titan Lords
๏ COMPETE against other players around the world in global tournaments to show off your strength and earn amazing prizes

◆ Join your Tap Titans Friends on Reddit & Facebook ◆
www.reddit.com/r/TapTitans2
www.facebook.com/TapTitan

Recent changes:
- Hand of Midas reverted back to being stronger during boss battles
- Can now save up to 3 clan crates
- Time-cheater prevention
- Selling equipments bug fix
- Prestige Relic bug fix
- Skill Tree UI update
- Daily Reward gives perk correctly
- Power of Swiping not affecting pet bug fix
- Hero balancing

Related Tap Titans 2


Other users also looks for: almightyartifactsclansdefeatdrawninvadingjoinloyalmasternew

Download Tap Titans 2 1.0.3 APK File

Tap Titans 2

Download Tap Titans 2 1.0.3:

Proceed to Tap Titans 2 1.0.3 APK Download Page > >

  • Size: 139519 kb
  • Os Support: Android
Sponsored links

DISCLAIMER: Tap Titans 2 is the property and trademark from , all rights reserved by Click on the above link to proceed to the APK file download page or app buy page.

What's New in Tap Titans 2 1.0.3

Recommended for You

You May Also Like (Similar or Related Apps)

  • مريم - Mariam مريم - Mariam
    ★★★★★★★★ مرحبا بكم في لعبة مريم النسخة الاصلية ★★★★★★★★ مريم فتاة جميلة تعيش في صراع ويجب عليك مساعدتها في الخروج من الظلام الى النور قصة درامية ممتعة لعبة مريم مريم قصة اللعبة تكمن في وجود فتاة صغ…
  • All Football All Football
    The All Football app gives you the latest and complete football news,Live Score and match videos&Highlights. Feel free to download it now! Live Scores You can get the live scores and instant pus…
  • Nintendo Switch Parental Cont… Nintendo Switch Parental Cont…
    Nintendo Switch Parental Controls™ is a free app for smart devices to keep you engaged with your family's gaming activities on Nintendo Switch. ◆ A Nintendo Switch console is required to use th…
  • Mario Bautista Mario Bautista
    Follow Mario Bautista through his Official App smarturl.it/MarioBautista. Download the free Mario Bautista app now! Stay connected to Mario Bautista on his official app. Do fun things: - Check out …
  • ShowBox ShowBox
    ShowBox lets you watch Copyleft movies in the public domain Recent changes: Faster
  • Mahjong Puzzles Solitaire Mahjong Puzzles Solitaire
    Find out the secret of Mahjong Puzzle, match all artwork tiles, go through all gates and enjoy the patience and strength of your mind!
  • Ma Thiên Ký Ma Thiên Ký
    Ma Thien Ky Mobile có gì hấp dẫn 1. Đồ họa sống động, màu sắc bắt mắt. 2. Chức năng chuyển sinh - lần đầu tiên xuất hiện trong game tiên hiệp: - Tu vi lên c…
  • Astro Boy Astro Boy
    Dreaming of outer space traveling? You are in the right place! 
Welcome to crazy space adventure with Astro Boy! Fly in space with astro boy and explore lots of planets and collect bright stars. Be c…
  • mPlayer - H265,HEVC Player mPlayer - H265,HEVC Player
    mPlayer will play most media format with advanced hardware acceleration engine - Fully hardware accelerated H264, H265, HEVC player. - Supported media format: MKV, TS, MPG, AVI, MP4, MOV.... - Suppor…
  • Con - KakaoTalk Theme Con - KakaoTalk Theme
    Add a little green to your KakaoTalk with the Con Theme. Con’s best friend Muzi has made a cameo appearance in this theme, so be sure to check that out as well! ========== * This theme is onl…